SCOPe 2.08: Domain d6e7dq_: 6e7d Q:

Lineage for d6e7dq_ (6e7d Q:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries)

8. Domain d6e7dq_: 6e7d Q: [359365]
   Other proteins in same PDB: d6e7da2, d6e7dc2, d6e7dd2, d6e7dg2, d6e7di2, d6e7dk2, d6e7dm2, d6e7do2
   automated match to d1yxja_
   complexed with nag, so4

Details for d6e7dq_

PDB Entry: 6e7d, 2.9 Å

PDB Description: structure of the inhibitory nkr-p1b receptor bound to the host-encoded ligand, clr-b

PDB Compounds: (Q:) Killer cell lectin-like receptor subfamily B member 1B allele B

SCOPe Domain Sequences for d6e7dq_:

Sequence, based on SEQRES records:

>d6e7dq_ d.169.1.0 (Q:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
sfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdnrwic
qkel

Sequence, based on observed residues (ATOM records):

>d6e7dq_ d.169.1.0 (Q:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
sfwiglsytnwkwingtafnsditgvtengscaaisgekvtsegcssdnrwicqkel

Timeline for d6e7dq_:

• d6e7dq_ first appeared in SCOPe 2.07