Lineage for d6e7dq_ (6e7d Q:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002670Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries)
  8. 3002738Domain d6e7dq_: 6e7d Q: [359365]
    Other proteins in same PDB: d6e7da2, d6e7dc2, d6e7dd2, d6e7dg2, d6e7di2, d6e7dk2, d6e7dm2, d6e7do2
    automated match to d1yxja_
    complexed with nag, so4

Details for d6e7dq_

PDB Entry: 6e7d (more details), 2.9 Å

PDB Description: structure of the inhibitory nkr-p1b receptor bound to the host-encoded ligand, clr-b
PDB Compounds: (Q:) Killer cell lectin-like receptor subfamily B member 1B allele B

SCOPe Domain Sequences for d6e7dq_:

Sequence, based on SEQRES records: (download)

>d6e7dq_ d.169.1.0 (Q:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
sfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdnrwic
qkel

Sequence, based on observed residues (ATOM records): (download)

>d6e7dq_ d.169.1.0 (Q:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekyn
sfwiglsytnwkwingtafnsditgvtengscaaisgekvtsegcssdnrwicqkel

SCOPe Domain Coordinates for d6e7dq_:

Click to download the PDB-style file with coordinates for d6e7dq_.
(The format of our PDB-style files is described here.)

Timeline for d6e7dq_: