Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries) |
Domain d6e7dl_: 6e7d L: [359227] Other proteins in same PDB: d6e7da2, d6e7dc2, d6e7dd2, d6e7dg2, d6e7di2, d6e7dk2, d6e7dm2, d6e7do2 automated match to d3rs1a_ complexed with nag, so4 |
PDB Entry: 6e7d (more details), 2.9 Å
SCOPe Domain Sequences for d6e7dl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e7dl_ d.169.1.0 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mnktyaacpqnwigvenkcfyfseypsnwtfaqafcmaqeaqlarfdnqdelnflmryka nfdswiglhressehpwkwtdnteynntipirgeerfaylnnngisstriyslrmwicsk ln
Timeline for d6e7dl_:
View in 3D Domains from other chains: (mouse over for more information) d6e7da1, d6e7da2, d6e7db_, d6e7dc1, d6e7dc2, d6e7dd1, d6e7dd2, d6e7de_, d6e7df_, d6e7dg1, d6e7dg2, d6e7dh_, d6e7di1, d6e7di2, d6e7dj_, d6e7dk1, d6e7dk2, d6e7dm1, d6e7dm2, d6e7dn_, d6e7do1, d6e7do2, d6e7dp_, d6e7dq_, d6e7dr_, d6e7ds_, d6e7dt_, d6e7du_, d6e7dv_, d6e7dw_, d6e7dx_ |