SCOPe 2.08: Domain d1bp5c_: 1bp5 C:

Lineage for d1bp5c_ (1bp5 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Transferrin [53897] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53899] (20 PDB entries)

8. Domain d1bp5c_: 1bp5 C: [35894]
   N-terminal lobe

Details for d1bp5c_

PDB Entry: 1bp5, 2.2 Å

PDB Description: human serum transferrin, recombinant n-terminal lobe, apo form

PDB Compounds: (C:) protein (serum transferrin)

SCOPe Domain Sequences for d1bp5c_:

Sequence; same for both SEQRES and ATOM records:

>d1bp5c_ c.94.1.2 (C:) Transferrin {Human (Homo sapiens) [TaxId: 9606]}
ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
qyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdchl
aqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
kvpprmdakmylgyeyvtairnlregtcpeaptd

Timeline for d1bp5c_:

• d1bp5c_ first appeared (with stable ids) in SCOP 1.55
  
• d1bp5c_ appears in SCOPe 2.07