PDB entry 1bp5

View 1bp5 on RCSB PDB site
Description: human serum transferrin, recombinant n-terminal lobe, apo form
Class: metal transport
Keywords: iron transport, glycoprotein, transferrin, nlobe, iron-release, carbonate, metal transport
Deposited on 1998-08-12, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.203
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (serum transferrin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bp5a_
  • Chain 'B':
    Compound: protein (serum transferrin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bp5b_
  • Chain 'C':
    Compound: protein (serum transferrin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bp5c_
  • Chain 'D':
    Compound: protein (serum transferrin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bp5d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bp5A (A:)
    vpdktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadav
    tldaglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkscht
    glgrsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcs
    tlnqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykd
    chlaqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsah
    gflkvpprmdakmylgyeyvtairnlregtcpeaptd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bp5A (A:)
    ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
    aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
    rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
    qyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdchl
    aqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
    kvpprmdakmylgyeyvtairnlregtc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bp5B (B:)
    vpdktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadav
    tldaglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkscht
    glgrsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcs
    tlnqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykd
    chlaqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsah
    gflkvpprmdakmylgyeyvtairnlregtcpeaptd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bp5B (B:)
    ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
    aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
    rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
    qyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdchl
    aqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
    kvpprmdakmylgyeyvtairnlregtc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bp5C (C:)
    vpdktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadav
    tldaglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkscht
    glgrsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcs
    tlnqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykd
    chlaqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsah
    gflkvpprmdakmylgyeyvtairnlregtcpeaptd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bp5C (C:)
    ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
    aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
    rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
    qyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdchl
    aqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
    kvpprmdakmylgyeyvtairnlregtcpeaptd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bp5D (D:)
    vpdktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadav
    tldaglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkscht
    glgrsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcs
    tlnqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykd
    chlaqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsah
    gflkvpprmdakmylgyeyvtairnlregtcpeaptd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bp5D (D:)
    ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
    aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
    rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
    qyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdchl
    aqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
    kvpprmdakmylgyeyvtairnlregtcpeaptd