SCOPe 2.07: Domain d6fz1a1: 6fz1 A:4-389

Lineage for d6fz1a1 (6fz1 A:4-389)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein automated matches [190277] (13 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [226739] (12 PDB entries)

8. Domain d6fz1a1: 6fz1 A:4-389 [358934]
   Other proteins in same PDB: d6fz1a2
   automated match to d4fkba_
   complexed with ca, zn

Details for d6fz1a1

PDB Entry: 6fz1, 2.2 Å

PDB Description: crystal structure of lipase from geobacillus stearothermophilus t6 methanol stable variant l360f

PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d6fz1a1:

Sequence; same for both SEQRES and ATOM records:

>d6fz1a1 c.69.1.18 (A:4-389) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
srandapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwdr
aceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarml
vsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrffd
lqkavlkaaavasnvpytsqvydfkldqwglrrqpgesfdqyferlkrspvwtstdtary
dlsvpgaeklnqwvkaspntyylsfatertyrgaltgnyypelgmnafsavvcapflgsy
rnatlgiddrwlendgivnafsmngpkrgstdrivpydgtikkgvwndmgtynvdhfevi
gvdpnplfdirafylrlaeqlaslqp

Timeline for d6fz1a1:

• d6fz1a1 is new in SCOPe 2.07-stable
  
• d6fz1a1 appears in the current release, SCOPe 2.08