SCOPe 2.08: Domain d6ehaa_: 6eha A:

Lineage for d6ehaa_ (6eha A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
   Uniprot P09601

8. Domain d6ehaa_: 6eha A: [358483]
   automated match to d1ix3a_
   complexed with b5b, hem

Details for d6ehaa_

PDB Entry: 6eha, 2 Å

PDB Description: heme oxygenase 1 in complex with inhibitor

PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d6ehaa_:

Sequence; same for both SEQRES and ATOM records:

>d6ehaa_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d6ehaa_:

• d6ehaa_ first appeared in SCOPe 2.07