Lineage for d1lct__ (1lct -)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 321832Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 321833Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 322136Family c.94.1.2: Transferrin [53888] (3 proteins)
    further duplication: composed of two two-domain lobes
  6. 322137Protein Lactoferrin [53889] (6 species)
  7. 322167Species Human (Homo sapiens) [TaxId:9606] [53890] (20 PDB entries)
  8. 322169Domain d1lct__: 1lct - [35836]
    N-terminal lobe
    complexed with co3, fe

Details for d1lct__

PDB Entry: 1lct (more details), 2 Å

PDB Description: structure of the recombinant n-terminal lobe of human lactoferrin at 2.0 angstroms resolution

SCOP Domain Sequences for d1lct__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lct__ c.94.1.2 (-) Lactoferrin {Human (Homo sapiens)}
rsvqwcavsnpeatkcfqwqrnmrkvrgppvscikrdspiqciqaiaenradavtldggf
iyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglrrta
gwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenkcaf
ssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvdkfk
dchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllfkds
aigfsrvppridsglylgsgyfta

SCOP Domain Coordinates for d1lct__:

Click to download the PDB-style file with coordinates for d1lct__.
(The format of our PDB-style files is described here.)

Timeline for d1lct__: