SCOPe 2.08: Domain d1lcta_: 1lct A:

Lineage for d1lcta_ (1lct A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53890] (21 PDB entries)

8. Domain d1lcta_: 1lct A: [35836]
   N-terminal lobe
   complexed with co3, fe

Details for d1lcta_

PDB Entry: 1lct, 2 Å

PDB Description: structure of the recombinant n-terminal lobe of human lactoferrin at 2.0 angstroms resolution

PDB Compounds: (A:) lactoferrin

SCOPe Domain Sequences for d1lcta_:

Sequence; same for both SEQRES and ATOM records:

>d1lcta_ c.94.1.2 (A:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]}
rsvqwcavsnpeatkcfqwqrnmrkvrgppvscikrdspiqciqaiaenradavtldggf
iyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglrrta
gwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenkcaf
ssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvdkfk
dchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllfkds
aigfsrvppridsglylgsgyfta

Timeline for d1lcta_:

• d1lcta_ first appeared (with stable ids) in SCOP 1.55, called d1lct__
  
• d1lcta_ appears in SCOPe 2.07