Lineage for d1atg__ (1atg -)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186247Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 186248Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 186249Family c.94.1.1: Phosphate binding protein-like [53851] (18 proteins)
  6. 186355Protein Molybdate-binding protein, ModA [53883] (2 species)
  7. 186356Species Azotobacter vinelandii [TaxId:354] [53885] (1 PDB entry)
  8. 186357Domain d1atg__: 1atg - [35834]

Details for d1atg__

PDB Entry: 1atg (more details), 1.2 Å

PDB Description: azotobacter vinelandii periplasmic molybdate-binding protein

SCOP Domain Sequences for d1atg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atg__ c.94.1.1 (-) Molybdate-binding protein, ModA {Azotobacter vinelandii}
elkvvtatnflgtleqlagqfakqtghavvissgssgpvyaqivngapynvffsadeksp
ekldnqgfalpgsrftyaigklvlwsakpglvdnqgkvlagngwrhiaisnpqiapygla
gtqvlthlglldkltaqeriveansvgqahsqtasgaadlgfvalaqiiqaaakipgshw
fppanyyepivqqavitkstaekanaeqfmswmkgpkavaiikaagyvlpq

SCOP Domain Coordinates for d1atg__:

Click to download the PDB-style file with coordinates for d1atg__.
(The format of our PDB-style files is described here.)

Timeline for d1atg__: