SCOPe 2.08: Domain d1atga_: 1atg A:

Lineage for d1atga_ (1atg A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Molybdate-binding protein, ModA [53883] (3 species)

7. Species Azotobacter vinelandii [TaxId:354] [53885] (1 PDB entry)

8. Domain d1atga_: 1atg A: [35834]
   complexed with act, edo, so4, wo4

Details for d1atga_

PDB Entry: 1atg, 1.2 Å

PDB Description: azotobacter vinelandii periplasmic molybdate-binding protein

PDB Compounds: (A:) periplasmic molybdate-binding protein

SCOPe Domain Sequences for d1atga_:

Sequence; same for both SEQRES and ATOM records:

>d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]}
elkvvtatnflgtleqlagqfakqtghavvissgssgpvyaqivngapynvffsadeksp
ekldnqgfalpgsrftyaigklvlwsakpglvdnqgkvlagngwrhiaisnpqiapygla
gtqvlthlglldkltaqeriveansvgqahsqtasgaadlgfvalaqiiqaaakipgshw
fppanyyepivqqavitkstaekanaeqfmswmkgpkavaiikaagyvlpq

Timeline for d1atga_:

• d1atga_ first appeared (with stable ids) in SCOP 1.55, called d1atg__
  
• d1atga_ appears in SCOPe 2.07