Lineage for d1atga_ (1atg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914392Protein Molybdate-binding protein, ModA [53883] (3 species)
  7. 2914398Species Azotobacter vinelandii [TaxId:354] [53885] (1 PDB entry)
  8. 2914399Domain d1atga_: 1atg A: [35834]
    complexed with act, edo, so4, wo4

Details for d1atga_

PDB Entry: 1atg (more details), 1.2 Å

PDB Description: azotobacter vinelandii periplasmic molybdate-binding protein
PDB Compounds: (A:) periplasmic molybdate-binding protein

SCOPe Domain Sequences for d1atga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]}
elkvvtatnflgtleqlagqfakqtghavvissgssgpvyaqivngapynvffsadeksp
ekldnqgfalpgsrftyaigklvlwsakpglvdnqgkvlagngwrhiaisnpqiapygla
gtqvlthlglldkltaqeriveansvgqahsqtasgaadlgfvalaqiiqaaakipgshw
fppanyyepivqqavitkstaekanaeqfmswmkgpkavaiikaagyvlpq

SCOPe Domain Coordinates for d1atga_:

Click to download the PDB-style file with coordinates for d1atga_.
(The format of our PDB-style files is described here.)

Timeline for d1atga_: