Lineage for d6g46c2 (6g46 C:121-430)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2603960Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2603961Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2603962Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 2603987Protein automated matches [190524] (2 species)
    not a true protein
  7. 2603988Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (12 PDB entries)
  8. 2604029Domain d6g46c2: 6g46 C:121-430 [358157]
    Other proteins in same PDB: d6g46a1, d6g46b1, d6g46c1, d6g46d1
    automated match to d1kbpa2
    complexed with edo, elh, fe, fuc, gol, ipa, na, nag, so4, zn

Details for d6g46c2

PDB Entry: 6g46 (more details), 2.4 Å

PDB Description: red kidney bean purple acid phosphatase in complex with 2-(naphthalen- 1-yl)thiazole-4-carboxylic acid
PDB Compounds: (C:) Fe(3+)-Zn(2+) purple acid phosphatase

SCOPe Domain Sequences for d6g46c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g46c2 d.159.1.1 (C:121-430) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvdd

SCOPe Domain Coordinates for d6g46c2:

Click to download the PDB-style file with coordinates for d6g46c2.
(The format of our PDB-style files is described here.)

Timeline for d6g46c2: