SCOPe 2.08: Domain d6g46c2: 6g46 C:121-430

Lineage for d6g46c2 (6g46 C:121-430)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)

6. Protein automated matches [190524] (2 species)
   not a true protein

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (11 PDB entries)

8. Domain d6g46c2: 6g46 C:121-430 [358157]
   Other proteins in same PDB: d6g46a1, d6g46b1, d6g46c1, d6g46d1
   automated match to d1kbpa2
   complexed with edo, elh, fe, gol, ipa, na, nag, so4, zn

Details for d6g46c2

PDB Entry: 6g46, 2.4 Å

PDB Description: red kidney bean purple acid phosphatase in complex with 2-(naphthalen- 1-yl)thiazole-4-carboxylic acid

PDB Compounds: (C:) Fe(3+)-Zn(2+) purple acid phosphatase

SCOPe Domain Sequences for d6g46c2:

Sequence; same for both SEQRES and ATOM records:

>d6g46c2 d.159.1.1 (C:121-430) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvdd

Timeline for d6g46c2:

• d6g46c2 first appeared in SCOPe 2.07