Lineage for d1a99d_ (1a99 D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162976Protein Putrescine receptor (PotF) [53877] (1 species)
  7. 2162977Species Escherichia coli [TaxId:562] [53878] (1 PDB entry)
  8. 2162981Domain d1a99d_: 1a99 D: [35815]
    complexed with put

Details for d1a99d_

PDB Entry: 1a99 (more details), 2.2 Å

PDB Description: putrescine receptor (potf) from e. coli
PDB Compounds: (D:) putrescine-binding protein

SCOPe Domain Sequences for d1a99d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a99d_ c.94.1.1 (D:) Putrescine receptor (PotF) {Escherichia coli [TaxId: 562]}
qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg

SCOPe Domain Coordinates for d1a99d_:

Click to download the PDB-style file with coordinates for d1a99d_.
(The format of our PDB-style files is described here.)

Timeline for d1a99d_: