Lineage for d1a99d_ (1a99 D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28131Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 28132Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 28133Family c.94.1.1: Phosphate binding protein-like [53851] (16 proteins)
  6. 28266Protein Putrescine receptor (PotF) [53877] (1 species)
  7. 28267Species Escherichia coli [TaxId:562] [53878] (1 PDB entry)
  8. 28271Domain d1a99d_: 1a99 D: [35815]

Details for d1a99d_

PDB Entry: 1a99 (more details), 2.2 Å

PDB Description: putrescine receptor (potf) from e. coli

SCOP Domain Sequences for d1a99d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a99d_ c.94.1.1 (D:) Putrescine receptor (PotF) {Escherichia coli}
qktlhiynwsdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsasf
lerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkvk
avlgenapvdswdlilkpenleklkscgvsfldapeevfatvlnylgkdpnstkaddytg
patdlllklrpniryfhssqyindlangdicvaigwagdvwqasnrakeakngvnvsfsi
pkegamaffdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsae
vrenpgiyppadvraklftlkvqdpkidrvrtrawtkvksg

SCOP Domain Coordinates for d1a99d_:

Click to download the PDB-style file with coordinates for d1a99d_.
(The format of our PDB-style files is described here.)

Timeline for d1a99d_: