Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein Spermidine/putrescine-binding protein PotD [53875] (1 species) |
Species Escherichia coli [TaxId:562] [53876] (2 PDB entries) |
Domain d1poy4_: 1poy 4: [35811] complexed with spd |
PDB Entry: 1poy (more details), 2.5 Å
SCOPe Domain Sequences for d1poy4_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1poy4_ c.94.1.1 (4:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]} nntlyfynwteyvppglleqftketgikviystyesnetmyaklktykdgaydlvvpsty yvdkmrkegmiqkidkskltnfsnldpdmlnkpfdpnndysipyiwgataigvngdavdp ksvtswadlwkpeykgsllltddarevfqmalrklgysgnttdpkeieaaynelkklmpn vaafnsdnpanpymegevnlgmiwngsafvarqagtpidvvwpkeggifwmdslaipana knkegalklinfllrpdvakqvaetigyptpnlaarkllspevandktlypdaetiknge wqndvgaassiyeeyyqklkagr
Timeline for d1poy4_: