Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (26 species) not a true protein |
Species Galaxea fascicularis [TaxId:46745] [357997] (2 PDB entries) |
Domain d6ciub_: 6ciu B: [358076] automated match to d1xssb_ |
PDB Entry: 6ciu (more details), 1.7 Å
SCOPe Domain Sequences for d6ciub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ciub_ d.22.1.0 (B:) automated matches {Galaxea fascicularis [TaxId: 46745]} svikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvtegaplpfaydilttvf qygnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsnismrgdcffyditft gtnfppngpvmqkktlkwepstekmyvrdgvlkgdvnmallleggghyrcdfkttykakk dvrlpdyhfvdhrieilkhdkdynkvklyenavarysmlpsq
Timeline for d6ciub_: