Lineage for d6ciuc_ (6ciu C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. Protein automated matches [190526] (25 species)
    not a true protein
  7. Species Galaxea fascicularis [TaxId:46745] [357997] (2 PDB entries)
  8. Domain d6ciuc_: 6ciu C: [357998]
    automated match to d1xssb_

Details for d6ciuc_

PDB Entry: 6ciu (more details), 1.7000000000000002 Å

PDB Description: structure of a thr-rich interface in an azami green tetramer
PDB Compounds: (C:) Azami-Green

SCOPe Domain Sequences for d6ciuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ciuc_ d.22.1.0 (C:) automated matches {Galaxea fascicularis [TaxId: 46745]}
vikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvtegaplpfaydilttvfq
ygnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsnismrgdcffyditftg
tnfppngpvmqkktlkwepstekmyvrdgvlkgdvnmallleggghyrcdfkttykakkd
vrlpdyhfvdhrieilkhdkdynkvklyenavarysmlpsqak

SCOPe Domain Coordinates for d6ciuc_ are not available.

Timeline for d6ciuc_:

Domains from other chains:
(mouse over for more information)
d6ciua_, d6ciub_, d6ciud_