Lineage for d1xssb_ (1xss B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. Protein automated matches [190526] (25 species)
    not a true protein
  7. Species Favia favus [TaxId:102203] [188529] (4 PDB entries)
  8. Domain d1xssb_: 1xss B: [162104]
    automated match to d1mova_
    complexed with mg, na

Details for d1xssb_

PDB Entry: 1xss (more details), 1.6 Å

PDB Description: Semi-rational engineering of a green-emitting coral fluorescent protein into an efficient highlighter.
PDB Compounds: (B:) fluorescent protein

SCOPe Domain Sequences for d1xssb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xssb_ d.22.1.0 (B:) automated matches {Favia favus [TaxId: 102203]}
vsvitsemkmelrmegavnghkfvitgkgsgqpfegiqnmdltvieggplpfafdilttv
fdygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvye
irfdgvnfpangpvmqrktvkwepstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
kakkvvqlpdyhfvdhrieitshdkdynkvklyehakahsglprlak

SCOPe Domain Coordinates for d1xssb_ are not available.

Timeline for d1xssb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xssa_