Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein Dipeptide-binding protein [53870] (1 species) similar domain organization to oligopeptide-binding protein, OPPA |
Species Escherichia coli [TaxId:562] [53871] (2 PDB entries) |
Domain d1dppc_: 1dpp C: [35801] complexed with gly, leu |
PDB Entry: 1dpp (more details), 3.2 Å
SCOPe Domain Sequences for d1dppc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dppc_ c.94.1.1 (C:) Dipeptide-binding protein {Escherichia coli [TaxId: 562]} ktlvycsegspegfnpqlftsgttydassvplynrlvefkigttevipglaekwevsedg ktytfhlrkgvkwhdnkefkptrelnaddvvfsfdrqknaqnpyhkvsggsyeyfegmgl pelisevkkvddntvqfvltrpeapfladlamdfasilskeyadammkagtpekldlnpi gtgpfqlqqyqkdsrirykafdgywgtkpqidtlvfsitpdasvryaklqknecqvmpyp npadiarmkqdksinlmempglnvgylsynvqkkplddvkvrqaltyavnkdaiikavyq gagvsaknlipptmwgynddvqdytydpekakallkeaglekgfsidlwampvqrpynpn arrmaemiqadwakvgvqakivtyewgeylkrakdgehqtvmmgwtgdngdpdnffatlf scaaseqgsnyskwcykpfedliqparatddhnkrvelykqaqvvmhdqapaliiahstv fepvrkevkgyvvdplgkhhfenvsie
Timeline for d1dppc_: