Lineage for d1dppc_ (1dpp C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144453Protein Dipeptide-binding protein [53870] (1 species)
    similar domain organization to oligopeptide-binding protein, OPPA
  7. 2144454Species Escherichia coli [TaxId:562] [53871] (2 PDB entries)
  8. 2144457Domain d1dppc_: 1dpp C: [35801]
    complexed with gly, leu

Details for d1dppc_

PDB Entry: 1dpp (more details), 3.2 Å

PDB Description: dipeptide binding protein complex with glycyl-l-leucine
PDB Compounds: (C:) dipeptide binding protein

SCOPe Domain Sequences for d1dppc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dppc_ c.94.1.1 (C:) Dipeptide-binding protein {Escherichia coli [TaxId: 562]}
ktlvycsegspegfnpqlftsgttydassvplynrlvefkigttevipglaekwevsedg
ktytfhlrkgvkwhdnkefkptrelnaddvvfsfdrqknaqnpyhkvsggsyeyfegmgl
pelisevkkvddntvqfvltrpeapfladlamdfasilskeyadammkagtpekldlnpi
gtgpfqlqqyqkdsrirykafdgywgtkpqidtlvfsitpdasvryaklqknecqvmpyp
npadiarmkqdksinlmempglnvgylsynvqkkplddvkvrqaltyavnkdaiikavyq
gagvsaknlipptmwgynddvqdytydpekakallkeaglekgfsidlwampvqrpynpn
arrmaemiqadwakvgvqakivtyewgeylkrakdgehqtvmmgwtgdngdpdnffatlf
scaaseqgsnyskwcykpfedliqparatddhnkrvelykqaqvvmhdqapaliiahstv
fepvrkevkgyvvdplgkhhfenvsie

SCOPe Domain Coordinates for d1dppc_:

Click to download the PDB-style file with coordinates for d1dppc_.
(The format of our PDB-style files is described here.)

Timeline for d1dppc_: