Lineage for d1dpea_ (1dpe A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. Protein Dipeptide-binding protein [53870] (1 species)
    similar domain organization to oligopeptide-binding protein, OPPA
  7. Species Escherichia coli [TaxId:562] [53871] (2 PDB entries)
  8. Domain d1dpea_: 1dpe A: [35799]
    complexed with cd

Details for d1dpea_

PDB Entry: 1dpe (more details), 2 Å

PDB Description: dipeptide-binding protein
PDB Compounds: (A:) dipeptide-binding protein

SCOPe Domain Sequences for d1dpea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpea_ c.94.1.1 (A:) Dipeptide-binding protein {Escherichia coli [TaxId: 562]}
ktlvycsegspegfnpqlfisgttydassvplynrlvefkigttevipglaekwevsedg
ktytfhlrkgvkwhdnkefkptrelnaddvvfsfdrqknaqnpyhkvsggsyeyfegmgl
pelisevkkvddntvqfvltrpeapfladlamdfasilskeyadammkagtpekldlnpi
gtgpfqlqqyqkdsrirykafdgywgtkpqidtlvfsitpdasvryaklqknecqvmpyp
npadiarmkqdksinlmempglnvgylsynvqkkplddvkvrqaltyavnkdaiikavyq
gagvsaknlipptmwgynddvqdytydpekakallkeaglekgfsidlwampvqrpynpn
arrmaemiqadwakvgvqakivtyewgeylkrakdgehqtvmmgwtgdngdpdnffatef
scaaseqgsnyskwcykpfedliqparatddhnkrvelykqaqvvmhdqapaliiahstv
fepvrkevkgyvvdplgkhhfenvsie

SCOPe Domain Coordinates for d1dpea_ are not available.

Timeline for d1dpea_: