PDB entry 1dpe

View 1dpe on RCSB PDB site
Description: dipeptide-binding protein
Class: peptide transport
Keywords: peptide transport, periplasmic, chemotaxis binding proteins for active transport
Deposited on 1995-07-25, released 1996-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptide-binding protein
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23847 (0-506)
      • conflict (19)
      • conflict (418)
    Domains in SCOPe 2.07: d1dpea_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dpeA (A:)
    ktlvycsegspegfnpqlfisgttydassvplynrlvefkigttevipglaekwevsedg
    ktytfhlrkgvkwhdnkefkptrelnaddvvfsfdrqknaqnpyhkvsggsyeyfegmgl
    pelisevkkvddntvqfvltrpeapfladlamdfasilskeyadammkagtpekldlnpi
    gtgpfqlqqyqkdsrirykafdgywgtkpqidtlvfsitpdasvryaklqknecqvmpyp
    npadiarmkqdksinlmempglnvgylsynvqkkplddvkvrqaltyavnkdaiikavyq
    gagvsaknlipptmwgynddvqdytydpekakallkeaglekgfsidlwampvqrpynpn
    arrmaemiqadwakvgvqakivtyewgeylkrakdgehqtvmmgwtgdngdpdnffatef
    scaaseqgsnyskwcykpfedliqparatddhnkrvelykqaqvvmhdqapaliiahstv
    fepvrkevkgyvvdplgkhhfenvsie