SCOPe 2.02: Domain d1qula_: 1qul A:

Lineage for d1qula_ (1qul A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Phosphate-binding protein [53860] (4 species)

7. Species Escherichia coli [TaxId:562] [53861] (13 PDB entries)

8. Domain d1qula_: 1qul A: [35766]
   complexed with cl, po4; mutant

Details for d1qula_

PDB Entry: 1qul, 1.7 Å

PDB Description: phosphate-binding protein mutant with asp 137 replaced by thr complex with chlorine and phosphate

PDB Compounds: (A:) phosphate-binding protein

SCOPe Domain Sequences for d1qula_:

Sequence; same for both SEQRES and ATOM records:

>d1qula_ c.94.1.1 (A:) Phosphate-binding protein {Escherichia coli [TaxId: 562]}
easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasdapls
deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln
pglklpsqniavvrratgsgtsfvftsylakvneewknnvgtgstvkwpiglggkgndgi
aafvqrlpgaigyveyayakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd
ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv
veqvraawktnikdssgkply

Timeline for d1qula_:

• d1qula_ first appeared (with stable ids) in SCOP 1.55, called d1qul__
  
• d1qula_ appears in SCOPe 2.01
  
• d1qula_ appears in SCOPe 2.03
  
• d1qula_ appears in the current release, SCOPe 2.08