Lineage for d1qula_ (1qul A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1186012Protein Phosphate-binding protein [53860] (4 species)
  7. 1186013Species Escherichia coli [TaxId:562] [53861] (13 PDB entries)
  8. 1186019Domain d1qula_: 1qul A: [35766]
    complexed with cl, po4; mutant

Details for d1qula_

PDB Entry: 1qul (more details), 1.7 Å

PDB Description: phosphate-binding protein mutant with asp 137 replaced by thr complex with chlorine and phosphate
PDB Compounds: (A:) phosphate-binding protein

SCOPe Domain Sequences for d1qula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qula_ c.94.1.1 (A:) Phosphate-binding protein {Escherichia coli [TaxId: 562]}
easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasdapls
deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln
pglklpsqniavvrratgsgtsfvftsylakvneewknnvgtgstvkwpiglggkgndgi
aafvqrlpgaigyveyayakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd
ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv
veqvraawktnikdssgkply

SCOPe Domain Coordinates for d1qula_:

Click to download the PDB-style file with coordinates for d1qula_.
(The format of our PDB-style files is described here.)

Timeline for d1qula_: