![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83334] [357648] (1 PDB entry) |
![]() | Domain d6b0db_: 6b0d B: [357649] automated match to d1f33f_ complexed with fmt, na |
PDB Entry: 6b0d (more details), 1.5 Å
SCOPe Domain Sequences for d6b0db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b0db_ a.25.1.1 (B:) automated matches {Escherichia coli [TaxId: 83334]} nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta lidhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv rkaigeakdddtadiltaasrdldkflwfiesnie
Timeline for d6b0db_: