SCOPe 2.08: Domain d5o03c1: 5o03 C:6-135

Lineage for d5o03c1 (5o03 C:6-135)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5o03c1: 5o03 C:6-135 [357584]
   Other proteins in same PDB: d5o03a_, d5o03b_, d5o03c2, d5o03d2
   automated match to d5hggs_
   complexed with edo, imd

Details for d5o03c1

PDB Entry: 5o03, 2.19 Å

PDB Description: gii.10 vietnam 026 protruding domain in complex with nanobody nano-32

PDB Compounds: (C:) Nanobody (VHH) Nano-32

SCOPe Domain Sequences for d5o03c1:

Sequence, based on SEQRES records:

>d5o03c1 b.1.1.1 (C:6-135) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftlgyypigwfrqapgkglegvscisgsggsanyaasvk
grftisrdnakntvylqmnslkpedtaiyycaadlsslttvqamcviprpgfsakaydyw
glgtqvtvss

Sequence, based on observed residues (ATOM records):

>d5o03c1 b.1.1.1 (C:6-135) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftlgyypigwfrqapgkglegvscisgsggsanyaasvk
grftisrdnakntvylqmnslkpedtaiyycaadlsslqamcviprpgfsakaydywglg
tqvtvss

Timeline for d5o03c1:

• d5o03c1 first appeared in SCOPe 2.07