PDB entry 5o03

View 5o03 on RCSB PDB site
Description: GII.10 Vietnam 026 protruding domain in complex with Nanobody Nano-32
Class: viral protein
Keywords: Norovirus, Protruding domain, capsid, VHH, Nanobody, Viral protein
Deposited on 2017-05-16, released 2017-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Norwalk virus [TaxId:11983]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: capsid protein
    Species: Norwalk virus [TaxId:11983]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nanobody (VHH) Nano-32
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5O03 (0-134)
    Domains in SCOPe 2.07: d5o03c1, d5o03c2
  • Chain 'D':
    Compound: Nanobody (VHH) Nano-32
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5O03 (0-134)
    Domains in SCOPe 2.07: d5o03d1, d5o03d2
  • Heterogens: IMD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o03C (C:)
    qvqlqesggglvqpggslrlscaasgftlgyypigwfrqapgkglegvscisgsggsany
    aasvkgrftisrdnakntvylqmnslkpedtaiyycaadlsslttvqamcviprpgfsak
    aydywglgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o03C (C:)
    qvqlqesggglvqpggslrlscaasgftlgyypigwfrqapgkglegvscisgsggsany
    aasvkgrftisrdnakntvylqmnslkpedtaiyycaadlsslqamcviprpgfsakayd
    ywglgtqvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5o03D (D:)
    qvqlqesggglvqpggslrlscaasgftlgyypigwfrqapgkglegvscisgsggsany
    aasvkgrftisrdnakntvylqmnslkpedtaiyycaadlsslttvqamcviprpgfsak
    aydywglgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o03D (D:)
    qvqlqesggglvqpggslrlscaasgftlgyypigwfrqapgkglegvscisgsggsany
    aasvkgrftisrdnakntvylqmnslkpedtaiyycaadlsslvqamcviprpgfsakay
    dywglgtqvtvss