Lineage for d1olaa_ (1ola A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914521Protein Oligo-peptide binding protein (OPPA) [53852] (3 species)
    contains an additional alpha+beta domain inserted in the N-terminal domain
  7. 2914524Species Salmonella typhimurium [TaxId:90371] [53853] (32 PDB entries)
  8. 2914550Domain d1olaa_: 1ola A: [35746]
    complexed with ium
    has additional subdomain(s) that are not in the common domain

Details for d1olaa_

PDB Entry: 1ola (more details), 2.1 Å

PDB Description: the structural basis of multispecificity in the oligopeptide-binding protein oppa
PDB Compounds: (A:) oligo-peptide binding protein

SCOPe Domain Sequences for d1olaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1olaa_ c.94.1.1 (A:) Oligo-peptide binding protein (OPPA) {Salmonella typhimurium [TaxId: 90371]}
advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv
aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian
iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt
qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge
idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd
iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftadkplt
fdllyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcady
neptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaiv
pvyyyvnarlvkpwvggytgkdpldniyvknlyiikh

SCOPe Domain Coordinates for d1olaa_:

Click to download the PDB-style file with coordinates for d1olaa_.
(The format of our PDB-style files is described here.)

Timeline for d1olaa_: