SCOPe 2.07: Domain d6fr2a_: 6fr2 A:

Lineage for d6fr2a_ (6fr2 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)

6. Protein automated matches [271870] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [271874] (64 PDB entries)

8. Domain d6fr2a_: 6fr2 A: [357446]
   automated match to d4c4za_
   complexed with e3n, mg

Details for d6fr2a_

PDB Entry: 6fr2, 2.26 Å

PDB Description: soluble epoxide hydrolase in complex with lk864

PDB Compounds: (A:) Bifunctional epoxide hydrolase 2

SCOPe Domain Sequences for d6fr2a_:

Sequence; same for both SEQRES and ATOM records:

>d6fr2a_ c.69.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrv
lamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfy
pervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfksl
frasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrn
mernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqm
dkptevnqilikwldsdar

Timeline for d6fr2a_:

• d6fr2a_ is new in SCOPe 2.07-stable
  
• d6fr2a_ appears in the current release, SCOPe 2.08