![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Oligo-peptide binding protein (OPPA) [53852] (3 species) contains an additional alpha+beta domain inserted in the N-terminal domain |
![]() | Species Salmonella typhimurium [TaxId:90371] [53853] (32 PDB entries) |
![]() | Domain d2olba_: 2olb A: [35721] complexed with act, ium has additional subdomain(s) that are not in the common domain |
PDB Entry: 2olb (more details), 1.4 Å
SCOPe Domain Sequences for d2olba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2olba_ c.94.1.1 (A:) Oligo-peptide binding protein (OPPA) {Salmonella typhimurium [TaxId: 90371]} advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftadkplt fdllyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcady neptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaiv pvyyyvnarlvkpwvggytgkdpldniyvknlyiikh
Timeline for d2olba_: