SCOPe 2.07: Domain d5otjl2: 5otj L:113-214

Lineage for d5otjl2 (5otj L:113-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d5otjl2: 5otj L:113-214 [357116]
   Other proteins in same PDB: d5otja1, d5otjl1
   automated match to d1aqkl2
   complexed with ca, edo

Details for d5otjl2

PDB Entry: 5otj, 2.35 Å

PDB Description: monomeric polcalcin (phl p 7) in complex with two identical allergen- specific antibodies

PDB Compounds: (L:) 102.1F10 Fab light chain

SCOPe Domain Sequences for d5otjl2:

Sequence; same for both SEQRES and ATOM records:

>d5otjl2 b.1.1.2 (L:113-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d5otjl2:

• d5otjl2 is new in SCOPe 2.07-stable
  
• d5otjl2 appears in the current release, SCOPe 2.08