SCOPe 2.07: Domain d5otja1: 5otj A:1-112

Lineage for d5otja1 (5otj A:1-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d5otja1: 5otj A:1-112 [357104]
   Other proteins in same PDB: d5otja2, d5otjl2
   automated match to d1aqkl1
   complexed with ca, edo

Details for d5otja1

PDB Entry: 5otj, 2.35 Å

PDB Description: monomeric polcalcin (phl p 7) in complex with two identical allergen- specific antibodies

PDB Compounds: (A:) 102.1F10 Fab light chain

SCOPe Domain Sequences for d5otja1:

Sequence; same for both SEQRES and ATOM records:

>d5otja1 b.1.1.1 (A:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esaltqppsvsgapgqrvsisctggssnfgagydvhwyqqlpatapklliygnnnrpsgv
pdrfsgsksgtsaslaitglqaedegdyfcqsfdtslsgwifgggtkltvlg

Timeline for d5otja1:

• d5otja1 is new in SCOPe 2.07-stable
  
• d5otja1 appears in the current release, SCOPe 2.08