Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (31 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries) |
Domain d5zgeb_: 5zge B: [356553] automated match to d4eyba_ complexed with oh, zn, zz7 |
PDB Entry: 5zge (more details), 1 Å
SCOPe Domain Sequences for d5zgeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zgeb_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]} eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl r
Timeline for d5zgeb_: