Lineage for d4eyba_ (4eyb A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. Protein automated matches [190418] (31 species)
    not a true protein
  7. Species Klebsiella pneumoniae [TaxId:573] [189718] (102 PDB entries)
  8. Domain d4eyba_: 4eyb A: [251819]
    automated match to d4ey2a_
    complexed with 0wo, zn

Details for d4eyba_

PDB Entry: 4eyb (more details), 1.1600000000000001 Å

PDB Description: crystal structure of ndm-1 bound to hydrolyzed oxacillin
PDB Compounds: (A:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4eyba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eyba_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
r

SCOPe Domain Coordinates for d4eyba_ are not available.

Timeline for d4eyba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4eybb_