SCOPe 2.08: Domain d5yyud_: 5yyu D:

Lineage for d5yyud_ (5yyu D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:681288] [356122] (3 PDB entries)

8. Domain d5yyud_: 5yyu D: [356123]
   Other proteins in same PDB: d5yyua2
   automated match to d2vw9a_

Details for d5yyud_

PDB Entry: 5yyu, 2.98 Å

PDB Description: crystal structure of staphylococcus aureus single-stranded dna-binding protein ssbb

PDB Compounds: (D:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d5yyud_:

Sequence, based on SEQRES records:

>d5yyud_ b.40.4.0 (D:) automated matches {Staphylococcus aureus [TaxId: 681288]}
mlnrvvlvgrltkdpelrstpngvnvgtftlavnrtftnaqgereadfinvvvfkkqaen
vknylskgslagvdgrlqtrnyenkdgqrvfvtevvadsvqfle

Sequence, based on observed residues (ATOM records):

>d5yyud_ b.40.4.0 (D:) automated matches {Staphylococcus aureus [TaxId: 681288]}
mlnrvvlvgrltkdpelrstpngvnvgtftlavnrteadfinvvvfkkqaenvknylskg
slagvdgrlqtrnvfvtevvadsvqfle

Timeline for d5yyud_:

• d5yyud_ first appeared in SCOPe 2.07