PDB entry 5yyu

View 5yyu on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus single-stranded DNA-binding protein SsbB
Class: DNA binding protein
Keywords: single-strand DNA binding protein, Staphylococcus aureus, DNA BINDING PROTEIN
Deposited on 2017-12-11, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-stranded DNA-binding protein
    Species: Staphylococcus aureus subsp. aureus ED98 [TaxId:681288]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YYU (0-End)
    Domains in SCOPe 2.07: d5yyua1, d5yyua2
  • Chain 'B':
    Compound: Single-stranded DNA-binding protein
    Species: Staphylococcus aureus subsp. aureus ED98 [TaxId:681288]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YYU (0-End)
    Domains in SCOPe 2.07: d5yyub_
  • Chain 'C':
    Compound: Single-stranded DNA-binding protein
    Species: Staphylococcus aureus subsp. aureus ED98 [TaxId:681288]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YYU (0-End)
    Domains in SCOPe 2.07: d5yyuc_
  • Chain 'D':
    Compound: Single-stranded DNA-binding protein
    Species: Staphylococcus aureus subsp. aureus ED98 [TaxId:681288]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YYU (0-End)
    Domains in SCOPe 2.07: d5yyud_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yyuA (A:)
    mlnrvvlvgrltkdpelrstpngvnvgtftlavnrtftnaqgereadfinvvvfkkqaen
    vknylskgslagvdgrlqtrnyenkdgqrvfvtevvadsvqflepkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yyuA (A:)
    mlnrvvlvgrltkdpelrstpngvnvgtftlavnrtftnaqgereadfinvvvfkkqaen
    vknylskgslagvdgrlqtrnyenkdgqrvfvtevvadsvqflepk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yyuB (B:)
    mlnrvvlvgrltkdpelrstpngvnvgtftlavnrtftnaqgereadfinvvvfkkqaen
    vknylskgslagvdgrlqtrnyenkdgqrvfvtevvadsvqflepkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yyuB (B:)
    mlnrvvlvgrltkdpelrstpngvnvgtftlavnrtftnaqgereadfinvvvfkkqaen
    vknylskgslagvdgrlqtrnyenkdgqrvfvtevvadsvqfle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yyuC (C:)
    mlnrvvlvgrltkdpelrstpngvnvgtftlavnrtftnaqgereadfinvvvfkkqaen
    vknylskgslagvdgrlqtrnyenkdgqrvfvtevvadsvqflepkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yyuC (C:)
    mlnrvvlvgrltkdpelrsvnvgtftlavnrtftnaqgereadfinvvvfkkqaenvkny
    lskgslagvdgrlqtrnyenkdgqrvfvtevvadsvqflep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yyuD (D:)
    mlnrvvlvgrltkdpelrstpngvnvgtftlavnrtftnaqgereadfinvvvfkkqaen
    vknylskgslagvdgrlqtrnyenkdgqrvfvtevvadsvqflepkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yyuD (D:)
    mlnrvvlvgrltkdpelrstpngvnvgtftlavnrteadfinvvvfkkqaenvknylskg
    slagvdgrlqtrnvfvtevvadsvqfle