SCOPe 2.08: Domain d6f01a2: 6f01 A:81-213

Lineage for d6f01a2 (6f01 A:81-213)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries)

8. Domain d6f01a2: 6f01 A:81-213 [356020]
   Other proteins in same PDB: d6f01a1, d6f01b1
   automated match to d1aw9a1
   complexed with br, gol, gs8, gts

Details for d6f01a2

PDB Entry: 6f01, 2.5 Å

PDB Description: arabidopsis thaliana gstf9, gso3 and gsoh bound

PDB Compounds: (A:) Glutathione S-transferase F9

SCOPe Domain Sequences for d6f01a2:

Sequence, based on SEQRES records:

>d6f01a2 a.45.1.0 (A:81-213) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gpdllgktvedrgqveqwldveattyhppllnltlhimfasvmgfpsdeklikeseekla
gvldvyeahlskskylagdfvsladlahlpftdylvgpigkaymikdrkhvsawwddiss
rpawketvakysf

Sequence, based on observed residues (ATOM records):

>d6f01a2 a.45.1.0 (A:81-213) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gpdllgktvedrgqveqwldveattyhppllnltlhimfadeklikeseeklagvldvye
ahlskskylagdfvsladlahlpftdylvgpigkaymikdrkhvsawwddissrpawket
vakysf

Timeline for d6f01a2:

• d6f01a2 first appeared in SCOPe 2.07