Lineage for d1aw9a1 (1aw9 A:83-217)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) 
Protein Class phi GST [81356] (3 species) Species Maize (Zea mays), type III [TaxId:4577] [47637] (1 PDB entry) 
Domain d1aw9a1: 1aw9 A:83-217 [17736]
Other proteins in same PDB: d1aw9a2
complexed with cd
Details for d1aw9a1
PDB Entry: 1aw9 (more details), 2.2 Å
PDB Description: structure of glutathione s-transferase iii in apo form
PDB Compounds: (A:) glutathione s-transferase IIISCOPe Domain Sequences for d1aw9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]}
gtdllpatasaaklevwleveshhfypnasplvfqllvrpllggapdaavvdkhaeqlak
vldvyeahlarnkylagdeftladanhasyllylsktpkaglvaarphvkawweaivarp
afqktvaaiplpppp
SCOPe Domain Coordinates for d1aw9a1:
Click to download the PDB-style file with coordinates for d1aw9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aw9a1:
- d1aw9a1 first appeared (with stable ids) in SCOP 1.55, called d1aw9_1
- d1aw9a1 appears in SCOPe 2.07
View in 3D
