SCOPe 2.07: Domain d5y42f1: 5y42 F:1-133

Lineage for d5y42f1 (5y42 F:1-133)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (9 species)
   not a true protein

7. Species Trichosanthes anguina [TaxId:50544] [226741] (3 PDB entries)

8. Domain d5y42f1: 5y42 F:1-133 [355937]
   automated match to d4hr6c1
   complexed with nag

Details for d5y42f1

PDB Entry: 5y42, 2.9 Å

PDB Description: native-crystal structure of three chain non-toxic type ii ribosome inactivating protein purified from the seeds of trichosanthes anguina

PDB Compounds: (F:) seed lectin

SCOPe Domain Sequences for d5y42f1:

Sequence; same for both SEQRES and ATOM records:

>d5y42f1 b.42.2.0 (F:1-133) automated matches {Trichosanthes anguina [TaxId: 50544]}
neclvetrttrisgrdalcvdvagaltsdgsrlilypcgqqvnqkwtfhsdgtvrslgkc
latnnskfgnlvviydcsklaaediswdvsvggtimnpnyedlaltsnkatrstnltmev
ntysasqgwrvgn

Timeline for d5y42f1:

• d5y42f1 is new in SCOPe 2.07-stable
  
• d5y42f1 appears in the current release, SCOPe 2.08