SCOPe 2.07: Domain d6gmxe1: 6gmx E:17-111

Lineage for d6gmxe1 (6gmx E:17-111)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Elongin C [54699] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (54 PDB entries)

8. Domain d6gmxe1: 6gmx E:17-111 [355792]
   Other proteins in same PDB: d6gmxa_, d6gmxc_, d6gmxd_, d6gmxe2, d6gmxf_, d6gmxg_, d6gmxi_, d6gmxj_, d6gmxk2, d6gmxl_
   automated match to d1lm8c_
   complexed with act, f7b, ipa

Details for d6gmxe1

PDB Entry: 6gmx, 2.53 Å

PDB Description: pvhl:elob:eloc in complex with 6-chlorothiochroman-4-one

PDB Compounds: (E:) Elongin-C

SCOPe Domain Sequences for d6gmxe1:

Sequence, based on SEQRES records:

>d6gmxe1 d.42.1.1 (E:17-111) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfld

Sequence, based on observed residues (ATOM records):

>d6gmxe1 d.42.1.1 (E:17-111) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvrytn
ssteipefpiapeialellmaanfld

Timeline for d6gmxe1:

• d6gmxe1 is new in SCOPe 2.07-stable
  
• d6gmxe1 appears in the current release, SCOPe 2.08