Lineage for d6gmxl_ (6gmx L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378586Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2378587Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2378588Protein VHL [49470] (1 species)
  7. 2378589Species Human (Homo sapiens) [TaxId:9606] [49471] (39 PDB entries)
  8. 2378698Domain d6gmxl_: 6gmx L: [355771]
    Other proteins in same PDB: d6gmxa_, d6gmxb_, d6gmxd_, d6gmxe1, d6gmxe2, d6gmxg_, d6gmxh_, d6gmxj_, d6gmxk1, d6gmxk2
    automated match to d1lqbc_
    complexed with act, f7b, ipa

Details for d6gmxl_

PDB Entry: 6gmx (more details), 2.53 Å

PDB Description: pvhl:elob:eloc in complex with 6-chlorothiochroman-4-one
PDB Compounds: (L:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6gmxl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gmxl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqer

SCOPe Domain Coordinates for d6gmxl_:

Click to download the PDB-style file with coordinates for d6gmxl_.
(The format of our PDB-style files is described here.)

Timeline for d6gmxl_: