Lineage for d6dxtb_ (6dxt B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037640Family g.44.1.5: Zf-UBP [161204] (4 proteins)
    Pfam PF02148
  6. 3037647Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species)
  7. 3037648Species Human (Homo sapiens) [TaxId:9606] [161208] (9 PDB entries)
    Uniprot P45974 169-285
  8. 3037657Domain d6dxtb_: 6dxt B: [355702]
    automated match to d2g45a_
    complexed with edo, hhy, unx, zn

Details for d6dxtb_

PDB Entry: 6dxt (more details), 1.95 Å

PDB Description: structure of usp5 zinc-finger ubiquitin binding domain co-crystallized with 3-(5-phenyl-1,3,4-oxadiazol-2-yl)propanoate
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 5

SCOPe Domain Sequences for d6dxtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dxtb_ g.44.1.5 (B:) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}
vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmq

SCOPe Domain Coordinates for d6dxtb_:

Click to download the PDB-style file with coordinates for d6dxtb_.
(The format of our PDB-style files is described here.)

Timeline for d6dxtb_: