SCOPe 2.08: Domain d6dxtb_: 6dxt B:

Lineage for d6dxtb_ (6dxt B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.5: Zf-UBP [161204] (4 proteins)
   Pfam PF02148

6. Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161208] (9 PDB entries)
   Uniprot P45974 169-285

8. Domain d6dxtb_: 6dxt B: [355702]
   automated match to d2g45a_
   complexed with edo, hhy, unx, zn

Details for d6dxtb_

PDB Entry: 6dxt, 1.95 Å

PDB Description: structure of usp5 zinc-finger ubiquitin binding domain co-crystallized with 3-(5-phenyl-1,3,4-oxadiazol-2-yl)propanoate

PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 5

SCOPe Domain Sequences for d6dxtb_:

Sequence; same for both SEQRES and ATOM records:

>d6dxtb_ g.44.1.5 (B:) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}
vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmq

Timeline for d6dxtb_:

• d6dxtb_ first appeared in SCOPe 2.07