PDB entry 6dxt

View 6dxt on RCSB PDB site
Description: Structure of USP5 zinc-finger ubiquitin binding domain co-crystallized with 3-(5-phenyl-1,3,4-oxadiazol-2-yl)propanoate
Class: hydrolase
Keywords: deubiquitinase, usp5, ubiquitin, structural genomics consortium, sgc, hydrolase
Deposited on 2018-06-29, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 5
    Species: Homo sapiens [TaxId:9606]
    Gene: USP5, ISOT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxta_
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase 5
    Species: Homo sapiens [TaxId:9606]
    Gene: USP5, ISOT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dxtb_
  • Heterogens: HHY, UNX, ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dxtA (A:)
    ggevrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsgg
    nnhavehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmqkt
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxtA (A:)
    vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
    avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dxtB (B:)
    ggevrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsgg
    nnhavehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmqkt
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dxtB (B:)
    vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
    avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmq