SCOPe 2.07: Domain d6dhya_: 6dhy A:

Lineage for d6dhya_ (6dhy A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein Cytochrome b562 [47177] (1 species)

7. Species Escherichia coli [TaxId:562] [47178] (63 PDB entries)

8. Domain d6dhya_: 6dhy A: [355334]
   automated match to d3m79a_
   complexed with ca, hem, zn

Details for d6dhya_

PDB Entry: 6dhy, 2.22 Å

PDB Description: crystallogrpahic tetramer of zn-bound ridc1 variant bearing two disulfide bonded cysteines

PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d6dhya_:

Sequence; same for both SEQRES and ATOM records:

>d6dhya_ a.24.3.1 (A:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr

Timeline for d6dhya_:

• d6dhya_ is new in SCOPe 2.07-stable
  
• d6dhya_ appears in the current release, SCOPe 2.08