![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) ![]() |
![]() | Family c.87.1.0: automated matches [191559] (1 protein) not a true family |
![]() | Protein automated matches [190965] (40 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256209] (9 PDB entries) |
![]() | Domain d6gneb_: 6gne B: [355202] automated match to d3guha_ complexed with adp |
PDB Entry: 6gne (more details), 2.55 Å
SCOPe Domain Sequences for d6gneb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gneb_ c.87.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} sglyvvhiaaemapvakvgglgdvvaglgkalqrkghlveiilpkydcmqydrvrdlral dtvvesyfdgklyknkiwigtveglpvhfiepqhpskffwrgqfygeqddfrrfsyfsra alelllqsgkkpdiihchdwqtafvaplywdlyapkgldsaricftchnfeyqgtasase lgscgldvnqlnrpdrmqdhssgdrvnpvkgaiifsnivttvsptyaqevrtaeggkglh stlnfhskkfigilngidtdswnpatdpflkaqfnakdlqgkeenkhalrkqlglssaes rrplvgcitrlvpqkgvhlirhaiyrtlelggqfvllgsspvphiqrefegieqqfkshd hvrlllkydealshtiyaasdlfiipsifepcgltqmiamrygsipiarktgglndsvfd idddtiptqfqngftfqtadeqgfnyalerafnhykkdeekwmrlvekvmsidfswgssa tqyeelytrsvsra
Timeline for d6gneb_: