PDB entry 6gne

View 6gne on RCSB PDB site
Description: Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose
Class: transferase
Keywords: Glycosyl Transferase, Starch Synthase, Acarbose, ADP, TRANSFERASE
Deposited on 2018-05-30, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable starch synthase 4, chloroplastic/amyloplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SS4, At4g18240, T9A21.90
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gnea_
  • Chain 'B':
    Compound: Probable starch synthase 4, chloroplastic/amyloplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SS4, At4g18240, T9A21.90
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6gneb_
  • Heterogens: ADP, ACR, MAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gneA (A:)
    lvssptssglyvvhiaaemapvakvgglgdvvaglgkalqrkghlveiilpkydcmqydr
    vrdlraldtvvesyfdgklyknkiwigtveglpvhfiepqhpskffwrgqfygeqddfrr
    fsyfsraalelllqsgkkpdiihchdwqtafvaplywdlyapkgldsaricftchnfeyq
    gtasaselgscgldvnqlnrpdrmqdhssgdrvnpvkgaiifsnivttvsptyaqevrta
    eggkglhstlnfhskkfigilngidtdswnpatdpflkaqfnakdlqgkeenkhalrkql
    glssaesrrplvgcitrlvpqkgvhlirhaiyrtlelggqfvllgsspvphiqrefegie
    qqfkshdhvrlllkydealshtiyaasdlfiipsifepcgltqmiamrygsipiarktgg
    lndsvfdidddtiptqfqngftfqtadeqgfnyalerafnhykkdeekwmrlvekvmsid
    fswgssatqyeelytrsvsraravpnrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gneA (A:)
    sglyvvhiaaemapvakvgglgdvvaglgkalqrkghlveiilpkydcmqydrvrdlral
    dtvvesyfdgklyknkiwigtveglpvhfiepqhpskffwrgqfygeqddfrrfsyfsra
    alelllqsgkkpdiihchdwqtafvaplywdlyapkgldsaricftchnfeyqgtasase
    lgscgldvnqlnrpdrmqdhssgdrvnpvkgaiifsnivttvsptyaqevrtaeggkglh
    stlnfhskkfigilngidtdswnpatdpflkaqfnakdlqgkeenkhalrkqlglssaes
    rrplvgcitrlvpqkgvhlirhaiyrtlelggqfvllgsspvphiqrefegieqqfkshd
    hvrlllkydealshtiyaasdlfiipsifepcgltqmiamrygsipiarktgglndsvfd
    idddtiptqfqngftfqtadeqgfnyalerafnhykkdeekwmrlvekvmsidfswgssa
    tqyeelytrsvsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6gneB (B:)
    lvssptssglyvvhiaaemapvakvgglgdvvaglgkalqrkghlveiilpkydcmqydr
    vrdlraldtvvesyfdgklyknkiwigtveglpvhfiepqhpskffwrgqfygeqddfrr
    fsyfsraalelllqsgkkpdiihchdwqtafvaplywdlyapkgldsaricftchnfeyq
    gtasaselgscgldvnqlnrpdrmqdhssgdrvnpvkgaiifsnivttvsptyaqevrta
    eggkglhstlnfhskkfigilngidtdswnpatdpflkaqfnakdlqgkeenkhalrkql
    glssaesrrplvgcitrlvpqkgvhlirhaiyrtlelggqfvllgsspvphiqrefegie
    qqfkshdhvrlllkydealshtiyaasdlfiipsifepcgltqmiamrygsipiarktgg
    lndsvfdidddtiptqfqngftfqtadeqgfnyalerafnhykkdeekwmrlvekvmsid
    fswgssatqyeelytrsvsraravpnrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gneB (B:)
    sglyvvhiaaemapvakvgglgdvvaglgkalqrkghlveiilpkydcmqydrvrdlral
    dtvvesyfdgklyknkiwigtveglpvhfiepqhpskffwrgqfygeqddfrrfsyfsra
    alelllqsgkkpdiihchdwqtafvaplywdlyapkgldsaricftchnfeyqgtasase
    lgscgldvnqlnrpdrmqdhssgdrvnpvkgaiifsnivttvsptyaqevrtaeggkglh
    stlnfhskkfigilngidtdswnpatdpflkaqfnakdlqgkeenkhalrkqlglssaes
    rrplvgcitrlvpqkgvhlirhaiyrtlelggqfvllgsspvphiqrefegieqqfkshd
    hvrlllkydealshtiyaasdlfiipsifepcgltqmiamrygsipiarktgglndsvfd
    idddtiptqfqngftfqtadeqgfnyalerafnhykkdeekwmrlvekvmsidfswgssa
    tqyeelytrsvsra