Lineage for d6fwhe1 (6fwh E:4-88)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2538081Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2538082Protein automated matches [190826] (22 species)
    not a true protein
  7. 2538083Species Acanthamoeba castellanii [TaxId:5755] [354894] (1 PDB entry)
  8. 2538092Domain d6fwhe1: 6fwh E:4-88 [355053]
    automated match to d1rhya1
    complexed with 5ld, mg, mn

Details for d6fwhe1

PDB Entry: 6fwh (more details), 1.79 Å

PDB Description: acanthamoeba igpd in complex with r-c348 to 1.7a resolution
PDB Compounds: (E:) Imidazoleglycerol-phosphate dehydratase

SCOPe Domain Sequences for d6fwhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fwhe1 d.14.1.0 (E:4-88) automated matches {Acanthamoeba castellanii [TaxId: 5755]}
reaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdlhv
ddhhtsedcaivlgqafrqaigerk

SCOPe Domain Coordinates for d6fwhe1:

Click to download the PDB-style file with coordinates for d6fwhe1.
(The format of our PDB-style files is described here.)

Timeline for d6fwhe1: