SCOPe 2.07: Domain d6fwhc2: 6fwh C:89-197

Lineage for d6fwhc2 (6fwh C:89-197)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (22 species)
   not a true protein

7. Species Acanthamoeba castellanii [TaxId:5755] [354894] (1 PDB entry)

8. Domain d6fwhc2: 6fwh C:89-197 [354926]
   automated match to d1rhya2
   complexed with 5ld, mg, mn

Details for d6fwhc2

PDB Entry: 6fwh, 1.79 Å

PDB Description: acanthamoeba igpd in complex with r-c348 to 1.7a resolution

PDB Compounds: (C:) Imidazoleglycerol-phosphate dehydratase

SCOPe Domain Sequences for d6fwhc2:

Sequence; same for both SEQRES and ATOM records:

>d6fwhc2 d.14.1.0 (C:89-197) automated matches {Acanthamoeba castellanii [TaxId: 5755]}
gikrygsayapldeslaravvdissrpfavidlklkrekigelscemiphvlhsfatsan
ltlhvevlygandhhkaesafkatalalreavtkdgpadavpstkgvle

Timeline for d6fwhc2:

• d6fwhc2 is new in SCOPe 2.07-stable
  
• d6fwhc2 appears in the current release, SCOPe 2.08