SCOPe 2.08: Domain d6byha2: 6byh A:76-155

Lineage for d6byha2 (6byh A:76-155)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)

6. Protein automated matches [226933] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)

8. Domain d6byha2: 6byh A:76-155 [354835]
   Other proteins in same PDB: d6byha1, d6byha3, d6byhb1, d6byhb3, d6byhc1, d6byhc2, d6byhd1, d6byhd2, d6byhg1, d6byhg3, d6byhh1, d6byhh2
   automated match to d5k35b2

Details for d6byha2

PDB Entry: 6byh, 2.61 Å

PDB Description: ubiquitin variant (ubv.fl11.1) bound to a human skp1-fbl11 fragment complex.

PDB Compounds: (A:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6byha2:

Sequence; same for both SEQRES and ATOM records:

>d6byha2 a.157.1.1 (A:76-155) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeei
rktfnikndfteeeeaqvrk

Timeline for d6byha2:

• d6byha2 first appeared in SCOPe 2.07