Lineage for d6byhg2 (6byh G:81-144)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735465Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2735466Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2735467Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 2735494Protein automated matches [226933] (1 species)
    not a true protein
  7. 2735495Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)
  8. 2735505Domain d6byhg2: 6byh G:81-144 [354833]
    Other proteins in same PDB: d6byha1, d6byha3, d6byhb1, d6byhb3, d6byhc1, d6byhc2, d6byhd1, d6byhd2, d6byhg1, d6byhg3, d6byhh1, d6byhh2
    automated match to d5k35b2

Details for d6byhg2

PDB Entry: 6byh (more details), 2.61 Å

PDB Description: ubiquitin variant (ubv.fl11.1) bound to a human skp1-fbl11 fragment complex.
PDB Compounds: (G:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6byhg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6byhg2 a.157.1.1 (G:81-144) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn
iknd

SCOPe Domain Coordinates for d6byhg2:

Click to download the PDB-style file with coordinates for d6byhg2.
(The format of our PDB-style files is described here.)

Timeline for d6byhg2: