SCOP 1.63: Domain d1php__: 1php -

Lineage for d1php__ (1php -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
   consists of two non-similar domains, 3 layers (a/b/a) each
   Domain 1 has parallel beta-sheet of 6 strands, order 342156
   Domain 2 has parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.86.1: Phosphoglycerate kinase [53748] (1 family)

5. Family c.86.1.1: Phosphoglycerate kinase [53749] (1 protein)
   Domain 2 binds ATP

6. Protein Phosphoglycerate kinase [53750] (5 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [53752] (1 PDB entry)

8. Domain d1php__: 1php - [35452]
   complexed with adp, mg

Details for d1php__

PDB Entry: 1php, 1.65 Å

PDB Description: structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms

SCOP Domain Sequences for d1php__:

Sequence; same for both SEQRES and ATOM records:

>d1php__ c.86.1.1 (-) Phosphoglycerate kinase {Bacillus stearothermophilus}
mnkktirdvdvrgkrvfcrvdfnvpmeqgaitddtriraalptiryliehgakvilashl
grpkgkvveelrldavakrlgellerpvaktneavgdevkaavdrlnegdvlllenvrfy
pgeekndpelakafaeladlyvndafgaahrahastegiahylpavagflmekelevlgk
alsnpdrpftaiiggakvkdkigvidnllekvdnliiggglaytfvkalghdvgksllee
dkielaksfmekakekgvrfympvdvvvadrfandantkvvpidaipadwsaldigpktr
elyrdviresklvvwngpmgvfemdafahgtkaiaealaealdtysvigggdsaaavekf
gladkmdhistgggaslefmegkqlpgvvaledk

Timeline for d1php__:

• d1php__ first appeared (with stable ids) in SCOP 1.55
  
• d1php__ appears in SCOP 1.61
  
• d1php__ appears in SCOP 1.65
  
• d1php__ appears in the current release, SCOPe 2.08, called d1phpa_